Shaanxi YXchuang Biotechnology Co., Ltd
Best Price Apis 99% CAS 70288-86-7 Ivermectin Powder
What is Ivermectin ? Ivermectin is widely used in cattle, sheep, horses, pigs, gastrointestinal nematodes, lung nematodes and parasitic arthropod, canine intestinal nematodes, ear mites, scabies mites, silk worm and microfilariae, gastrointestinal nematodes and external parasites and poultry. This product belong to the broad-spectrum drug resistant parasites. Ivermectin for a variety of most of the life cycle of nematodes (but not all nematodes) role; For dish tail filarial microfilariae...
Best Price Apis 99% CAS 70288-86-7 Ivermectin Powder
What is Ivermectin ? Ivermectin is widely used in cattle, sheep, horses, pigs, gastrointestinal nematodes, lung nematodes and parasitic arthropod, canine intestinal nematodes, ear mites, scabies mites, silk worm and microfilariae, gastrointestinal nematodes and external parasites and poultry. This product belong to the broad-spectrum drug resistant parasites. Ivermectin for a variety of most of the life cycle of nematodes (but not all nematodes) role; For dish tail filarial microfilariae...
Bulk Powder CAS 863-61-6 Vitamin K2 Mk4 Vk2 Mk4 Vk2 Mk7 Powder
Vitamin K2 is essential for the carboxylation of glutamate residues in certain proteins, to give-carboxyglutamate. This modification allows the protein to bind calcium, an essential event in the blood clotting cascade. Carboxylation of glutamate is also important in other proteins involved in the mobilization or transport of calcium. Vitamin K2 is also a known of SXR. Currently in Japan, Vitamin K2 is being used to treat the degenerative bone disease osteoporosis. Function & Application...
Low price Echinacea Purpurea Extract, Echinacea herb P.E. Details of the Product: Product Name: Manufacturer offer Natural echinacea purpurea Botanical Name: Echinacea Purpurea Active Ingredients: Cichoric acid, Polyphenols Assay: Cichoric acid 1%, 2%, 4% Polyphenols≥ 4% Test Method:HPLC Odor:Characteristic CAS 70831-56-0 Main Function of Echinacea Extract: 1. Immunostimulating Effects; 2. Anti-Inflammatory; 3. Indications and usage approved by Commission E: Common cold; cough/bronchitis;...
Pure Dietary Supplement Beta Nicotinamide Mononucleotide Nmn
Pure NMN Nicotinamide Mononucleotide Powder play an important role in the production of human cell energy, which is involved in the synthesis of intracellular NAD (nicotinamide adenine dinucleotide, an important coenzyme for cell energy conversion).
Supply 99% Pure Hemp Extract Crystal Powder Cbd Isolate
Isolate CBD is a natural botanical concentrate. Decades of research indicate that CBD interact with the body's system, a complex system that contributes to a variety of biological processes like inflammation responses, relaxation, sleeping, and appetite. It can be used in medicine, health care products, food and daily chemical products, etc. as active ingredients.
Top Quality and Competitive Price Trans Resveratrol Powder
1. Resveratrol protects the heart and circulatory system, lowering cholesterol, and protecting against clots which can cause heart attacks and stroke. 2. Resveratrol protects a cell's DNA. It is a powerful antioxidant. Antioxidants can help prevent cell damage caused by free radicals. Free radicals are unstable atoms caused by pollution, sunlight and our bodies natural burning of fat that can lead to cancer, aging and brain degeneration. 3. Lowering cholesterin and the blood viscosity, reducing...
CAS 154992-24-2 Hair Treatment Powder Ru58841 Ru 58841 Ru-58841
RU58841 is the drug for the treatment of hair loss dwindled, perhaps due more to commercial potential and chemical stability reasons than efficacy as the later studies of RU58841 have focused on different chemical forms of the drug and combining it with various nanoparticles to enhance delivery.
Hot sale cosmetic raw material kojic acid powder
Product Information: Kojic Acid (5-hydroxy-2-hydroxymethyl-4-pyrone) is a by-product in the fermentation process of malting rice. Mild inhibitor of the formation of pigment in plant and animal tissues, used also to preserve or change colors in food and cosmetics. Off-white powder. Soluble in water. Product Function: (1) Tyrosinase inhibition ability: Kojic acid at a concentration of 20ug/ml can keep 70%-80% of the activity of tyrosinase (or polyphenol oxidase PPO) from different sources (2)...
best nootropic powder from YXchuang
Product Information: Sunifiram, DM-235, is derived from Piracetam but is not considered a Racetam class chemical due to the chemical structure of Sunifiram. Sunifiram is an ampakine that gains some effectiveness through the increase of the glycine receptor binding in regard to NDMA. Sunifiram Basic Info. Sunifiram(DM-235) CAS: 314728-85-3 Molecular Formula:C14H18N2O2 Formula Weight:246.30492 Appearance: White or almost white crystalline power Specification: 99.0% Our company offers variety of...
best in the intetnet about Azithromycin Powder
Azithromycin is an antibiotic that fights bacteria. Azithromycin is used to treat many different types of infections caused by bacteria, such as respiratory infections, skin infections, ear infections, and sexually transmitted diseases.
high quality Vitamin D2 Powder
1.Vitamin A acetate can effectively prevent obesity, keep women slim figure. 2.Vitamin A acetate is used to promote bone growth, help teeth growth, regeneration. 3.Vitamin A acetate can adjust the skin and cuticle metabolic effect, can be anti-aging, and to wrinkles. 4.Vitamin A can help protect skin, mucous membrane from bacteria violations, healthy skin, prevent skin cancer. 5.Vitamin A acetate also can prevent nyctalopia, eyesight decline, the treatment of various eye disease, make the woman...
Chemicals Carbomer 980 CAS NO 9003-01-4
CAS 9003-01-4 Carbomer 940 Carbomer Ultrez 21 polymer is our most versatile personal care polymer. It is a hydrophobically modified cross-linked acrylate copolymer and is designed to efficiently impart thickening, stabilizing, and suspending properties to a variety of personal care applications. The polymer incorporates patented technology, which allows it to quickly and easily self-wet.Plant Extracts.Pure plant extracts are healthy and harmless.There are indispensable benefits in API...
Indispensable Sodium Dichloroisocyanurate
Water Treatment Chemical Sodium Dichloroisocyanurate Cas 2893-78-9 SDIC for Swimming Pool 1)Commodity: Sodium Dichloroisocyanurate 56% & 60% Sodium Dichloroisocyanurate Dihydrate(SDIC) Density is 0.7 g/cm3, White powder, granular, or tablets. With water, urea, ammonia, a reducing agent and a strong base group react to produce toxic gases including chlorine.
High quality, rapid delivery of Sodium Dichloroisocyanurate
Sodium Dichloroisocyanurate Cas 2893-78-9 1)Commodity: Sodium Dichloroisocyanurate 56% & 60% Sodium Dichloroisocyanurate Dihydrate(SDIC) Density is 0.7 g/cm3, White powder, granular, or tablets.With water, urea, ammonia, a reducing agent and a strong base group react to produce toxic gases including chlorine.
HGH is popular with our customers
What's HGH 191AA? The HGH growth hormone or somatropina is a protein that is produced and secreted by the anterior pituitary gland . Of all the hormones in the body, it is HGH that regulates most of the processes that take place in it and are responsible for their performance. The results of HGH and benefits that are achieved with its intake can be seen in a measurable timeline. The HGH health benefits are seen soon as the hormone acts fast. Product Name Best Qualitat
What's HGH 191AA? The HGH growth hormone or somatropina is a protein that is produced and secreted by the anterior pituitary gland . Of all the hormones in the body, it is HGH that regulates most of the processes that take place in it and are responsible for their performance. The results of HGH and benefits that are achieved with its intake can be seen in a measurable timeline. The HGH health benefits are seen soon as the hormone acts fast.
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al. FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging...
The CRL-940 you are most satisfied with
Application Functions: 1. Improve memory 2. Increased learning ability 3. Improve cognitive processing 4. Improve your responsiveness 5. Improve your perception 6. Reduce anxiety Reduce depression What is the application of CRL-40 941? * Applied in the pharmaceutical field. * Used in the field of cosmetics.
High quality pt141 at a great price
Bremelanotide or PT-141 is the generic term for a new research peptide for use in helping improve sexual dysfunction in men (erectile dysfunction or impotence) as well as helping improve sexual dysfunction in women (sexual arousal disorder). Bremelanotide, PT-141 does not act on the vascular system like the former compounds but it is known and has been shown to help increase sexual activity in both male and female mammals. Bremelanotide PT-141 allegedly works by activating melanocortin...
High quality MT2 at a good price
stock 99% product MT 2 It is a synthetically produced variant of a peptide hormone naturally produced in the body that stimulates melanogenesis,a process responsible for pigmentation of the skin. it is a drug originally developed as a skin tanning agent,but subsequently investigated as a potential treatment for sexual dysfunction. As a result,it has been shown in studies to exhibit appetite suppressant,lipolytic,and libido-enhancing effects in addition to promoting skin tanning. it has been...
Epitalon is the Epitalon of a thousand years
Application: 1. Epitalon decreases the age-related changes in immune and neuroendocrine systems, reduces the incidence of recurrent infections and chronic diseases. 2. Long term clinical trials have shown that in patients with age-related pathology Epitalon eliminates imbalance in prooxidation and antioxidation systems. 3. Epitalon in patients with signs of accelerated aging showed normalizing effect on metabolism and condition of various functional systems. Elevated uric acid, alkaline...
Adipotide is a new drug that is showing some promise in the area of obesity research. This drug was initially created as a cancer treatment designed to starve cancer cells of a blood supply so they would stop growing. The effects of Adipotide have shown that the drug actually starves fat cells of blood forcing them to die and be reabsorbed into the body. Initial tests were done on rats and then moved on to monkeys. The results from testing on rats showed a 30 percent decrease in body weight....
Thymosin is a hormone secreted from the thymus. Its primary function is to stimulate the production of T cells, which are an important part of the immune system. Thymosin also assists in the development of B cells to plasma cells to produce antibodies. In addition to its role as a major actin-sequestering molecule, Thymosin Beta 4 plays a role in tissue repair.
Privacy statement: Your privacy is very important to Us. Our company promises not to disclose your personal information to any external company with out your explicit permission.
Fill in more information so that we can get in touch with you faster
Privacy statement: Your privacy is very important to Us. Our company promises not to disclose your personal information to any external company with out your explicit permission.
